Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSGA10IP Peptide - middle region

TSGA10IP Peptide - middle region

Product Specifications

Product Name Alternative

TSGA10IP

UniProt

Q3SY00

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSGA10IP Rabbit Polyclonal Antibody (orb587784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GHQALPMPSSFSQRQSRRKSTANLPEAHGCCWKTEAQNLKARQQLGAWGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFAS Antibody, HRP conjugated
A31020-100UG 100 µg

PFAS Antibody, HRP conjugated

Sign In for Pricing
View Details
NUP62CL Human Gene Knockout Kit (CRISPR)
KN404990 1 Kit

NUP62CL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VSIG4 antibody
70R-1905 100 µL

VSIG4 antibody

Sign In for Pricing
View Details
9mm UltraBond Combi Seal PP Cap
CHR3356 10 / PCK

9mm UltraBond Combi Seal PP Cap

Sign In for Pricing
View Details
CASC3 Antibody
A15984-100UL 100 µL

CASC3 Antibody

Sign In for Pricing
View Details
Rnf103 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7104205 3x 1.0 µg

Rnf103 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details