Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERT Peptide - middle region

TERT Peptide - middle region

Product Specifications

Product Name Alternative

TERT, EST2, TCS1, TRT

UniProt

O14746

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TERT Rabbit Polyclonal Antibody (orb587884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-arfaptin 2 (Ser260) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2433386 100 µL

Phospho-arfaptin 2 (Ser260) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
NAPSA Antibody, Biotin conjugated
CSB-PA11529D0Rb-01 50 µg

NAPSA Antibody, Biotin conjugated

Sign In for Pricing
View Details
NAPSA Antibody, Biotin conjugated
CSB-PA11529D0Rb-02 100 µg

NAPSA Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Sphingosine 1 Phosphate Receptor 4 (S1PR4) ELISA Kit
MBS2024884-01 24 Strip Well

Mouse Sphingosine 1 Phosphate Receptor 4 (S1PR4) ELISA Kit

Sign In for Pricing
View Details
Mouse Sphingosine 1 Phosphate Receptor 4 (S1PR4) ELISA Kit
MBS2024884-02 48 Strip Well

Mouse Sphingosine 1 Phosphate Receptor 4 (S1PR4) ELISA Kit

Sign In for Pricing
View Details
Mouse Sphingosine 1 Phosphate Receptor 4 (S1PR4) ELISA Kit
MBS2024884-03 96 Strip Well

Mouse Sphingosine 1 Phosphate Receptor 4 (S1PR4) ELISA Kit

Sign In for Pricing
View Details