Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRSAM1 Peptide - N-terminal region

LRSAM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LRSAM1, TAL, UNQ6496/PRO21356

UniProt

Q6UWE0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRSAM1 Rabbit Polyclonal Antibody (orb588013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612370

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CDX2 Antibody Picoband® (Dylight488 Conjugate)
A00877-3-Dylight488 100 µg

Anti-CDX2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Dhx37 siRNA Oligos set (Rat)
18204176 3x 5 nmol

Dhx37 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rabbit Anti-Human NQO1 pAb
PA10510-01 50 μL

Rabbit Anti-Human NQO1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NQO1 pAb
PA10510-02 100 μL

Rabbit Anti-Human NQO1 pAb

Sign In for Pricing
View Details
MSTO1 Protein Vector (Mouse) (pPM-C-HA)
PV202512 500 ng

MSTO1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PCDNA3.1-HA-Ub-K29R
BZ11141 1 Vial

PCDNA3.1-HA-Ub-K29R

Sign In for Pricing
View Details