Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRSAM1 Peptide - N-terminal region

LRSAM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LRSAM1, TAL, UNQ6496/PRO21356

UniProt

Q6UWE0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRSAM1 Rabbit Polyclonal Antibody (orb588013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612370

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNB1 Blocking Peptide (C-term T321)
MBS9229053-01 0.5 mg

CCNB1 Blocking Peptide (C-term T321)

Sign In for Pricing
View Details
CCNB1 Blocking Peptide (C-term T321)
MBS9229053-02 5x 0.5 mg

CCNB1 Blocking Peptide (C-term T321)

Sign In for Pricing
View Details
Gpx4 (BC106147) Mouse Tagged ORF Clone
MG201418 10 µg

Gpx4 (BC106147) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
YB1 (YBX1) Mouse Monoclonal Antibody [Clone 2C9]
E45M17218V-2 50 µL

YB1 (YBX1) Mouse Monoclonal Antibody [Clone 2C9]

Sign In for Pricing
View Details
Polyclonal CHEK2 / CHK2 Antibody (N-Terminus)
APR02363G 0.05mg

Polyclonal CHEK2 / CHK2 Antibody (N-Terminus)

Sign In for Pricing
View Details
KLHDC4
MBS8577889-01 0.1 mL

KLHDC4

Sign In for Pricing
View Details