Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHC1 Peptide - N-terminal region

EFHC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFHC1

UniProt

Q5JVL4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFHC1 Rabbit Polyclonal Antibody (orb588097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060570

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-butyl 2- (6-bromopyridin-2-yl) acetate
OR1099027 1 Each

Tert-butyl 2- (6-bromopyridin-2-yl) acetate

Sign In for Pricing
View Details
Mouse Cenpj activation kit by CRISPRa
GA213589 1 Kit

Mouse Cenpj activation kit by CRISPRa

Sign In for Pricing
View Details
Plant Phytophthora cryptogea Beta-elicitin cryptogein protein
orb604598-01 20 µg

Plant Phytophthora cryptogea Beta-elicitin cryptogein protein

Sign In for Pricing
View Details
Plant Phytophthora cryptogea Beta-elicitin cryptogein protein
orb604598-02 100 µg

Plant Phytophthora cryptogea Beta-elicitin cryptogein protein

Sign In for Pricing
View Details
Plant Phytophthora cryptogea Beta-elicitin cryptogein protein
orb604598-03 1 mg

Plant Phytophthora cryptogea Beta-elicitin cryptogein protein

Sign In for Pricing
View Details
Stim1 siRNA (r)
sc-270596 10 µM

Stim1 siRNA (r)

Sign In for Pricing
View Details