EFHC1 Peptide - N-terminal region
EFHC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EFHC1
UniProt
Q5JVL4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EFHC1 Rabbit Polyclonal Antibody (orb588097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060570
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6008704-01 0.2 mL
KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8)
Sign In for Pricing
View Details MBS6008704-02 5x 0.2 mL
KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8)
Sign In for Pricing
View Details 
ARP50237_P050-HRP 100 µL
ANKH Antibody - N-terminal region : HRP (ARP50237_P050-HRP)
Sign In for Pricing
View Details 