Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXIN2 Peptide - N-terminal region

AXIN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AXIN2

UniProt

Q9Y2T1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AXIN2 Rabbit Polyclonal Antibody (orb574043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004646

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS637106 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TOR3A antibody
FNab08874 100 µg

TOR3A antibody

Sign In for Pricing
View Details
Vitamin B6 Microplate Assay Kit
RDSM162 100 Assays

Vitamin B6 Microplate Assay Kit

Sign In for Pricing
View Details
Andrographolide
TRC-A637475-50MG 50 mg

Andrographolide

Sign In for Pricing
View Details
Mouse ANXA5 (Annexin A5) CLIA Kit
E-CL-M0084-01 24 Tests

Mouse ANXA5 (Annexin A5) CLIA Kit

Sign In for Pricing
View Details
Mouse ANXA5 (Annexin A5) CLIA Kit
E-CL-M0084-02 48 Tests

Mouse ANXA5 (Annexin A5) CLIA Kit

Sign In for Pricing
View Details