Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXIN2 Peptide - N-terminal region

AXIN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AXIN2

UniProt

Q9Y2T1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AXIN2 Rabbit Polyclonal Antibody (orb574043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004646

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD97 (ADGRE5) Human Knockdown Lysate
LY300322 100 µg

CD97 (ADGRE5) Human Knockdown Lysate

Sign In for Pricing
View Details
DGCR8 (NM_022720) Human Over-expression Lysate
LC402934 20 µg

DGCR8 (NM_022720) Human Over-expression Lysate

Sign In for Pricing
View Details
ARPP21 Antibody
8C14899-AAT 50 µg

ARPP21 Antibody

Sign In for Pricing
View Details
Human CXCL5, Tag Free
HA210887-01 20 µg

Human CXCL5, Tag Free

Sign In for Pricing
View Details
Human CXCL5, Tag Free
HA210887-02 50 µg

Human CXCL5, Tag Free

Sign In for Pricing
View Details
Human CXCL5, Tag Free
HA210887-03 100 µg

Human CXCL5, Tag Free

Sign In for Pricing
View Details