ZBTB25 Peptide - middle region
ZBTB25 Peptide - middle region
Product Specifications
Product Name Alternative
ZBTB25, C14orf51, KUP, ZNF46
UniProt
P24278
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZBTB25 Rabbit Polyclonal Antibody (orb574712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005268110
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![3,4-Dihydro-2H-pyrido[1,2-A]pyrimidin-2-one](https://cdn.genprice.uk/products/572/33031069297/imageurl/trc-d493150-50mg.webp)
BNUM1853-50 1x 50 µL
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), 1mg/mL
Sign In for Pricing
View Details 
BNUM2560-50 1x 50 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), 1mg/mL
Sign In for Pricing
View Details 
GM-603-40 1 mL
HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 1mL 40nm
Sign In for Pricing
View Details 