Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB25 Peptide - middle region

ZBTB25 Peptide - middle region

Product Specifications

Product Name Alternative

ZBTB25, C14orf51, KUP, ZNF46

UniProt

P24278

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB25 Rabbit Polyclonal Antibody (orb574712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005268110

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR0B1 Mouse Monoclonal Antibody [Clone ID: OTI5F5]
CF805006 100 µg

NR0B1 Mouse Monoclonal Antibody [Clone ID: OTI5F5]

Sign In for Pricing
View Details
Orotidine 5'-Monophosphate Trisodium Salt
TRC-O691525-1MG 1 mg

Orotidine 5'-Monophosphate Trisodium Salt

Sign In for Pricing
View Details
Recombinant LPP Antibody
RC-16284-01 50 μL

Recombinant LPP Antibody

Sign In for Pricing
View Details
Recombinant LPP Antibody
RC-16284-02 100 µL

Recombinant LPP Antibody

Sign In for Pricing
View Details
Recombinant LPP Antibody
RC-16284-03 1 mL

Recombinant LPP Antibody

Sign In for Pricing
View Details
TIMP4 (NM_003256) Human Over-expression Lysate
LY401122 100 µg

TIMP4 (NM_003256) Human Over-expression Lysate

Sign In for Pricing
View Details