ZNF514 Peptide - middle region
ZNF514 Peptide - middle region
Product Specifications
Product Name Alternative
ZNF514
UniProt
Q96K75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb575787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116177
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLRSVLVNQHSILMGEGSYKCDTEFRQTLGGNNSQRTHPEKKSCKCNECG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC422993 20 µg
HNRNPCL1 (NM_001013631) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC042770-100 1x 100 µL
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC426586 20 µg
HIP55 (DBNL) (NM_001122956) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC401210-100 1x 100 µL
CD163 (Monocyte & Macrophage Marker) (M130/1210), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details