ZNF514 Peptide - middle region
ZNF514 Peptide - middle region
Product Specifications
Product Name Alternative
ZNF514
UniProt
Q96K75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb575787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116177
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLRSVLVNQHSILMGEGSYKCDTEFRQTLGGNNSQRTHPEKKSCKCNECG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MDA5 (IFIH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C10]](https://cdn.genprice.uk/products/937/68dd1b79061270361ea1bb88/imageurl/ta803667bm.webp)
TA803667BM 100 µL
MDA5 (IFIH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C10]
Sign In for Pricing
View Details 
BNC742232-100 1x 100 µL
Carbonic Anhydrase VIII (CPTC-CA8-2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP06924PU-N 50 µg
GPR10 (PRLHR) (2nd Extracel. Dom.) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 