Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALX3 Peptide - C-terminal region

ALX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALX3

UniProt

O95076

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALX3 Rabbit Polyclonal Antibody (orb576106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006483

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAAHPGIYSIHGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 450 Anti-human CD144 Antibody *55-7H1*
11440040-AAT 100 Tests

IFluor® 450 Anti-human CD144 Antibody *55-7H1*

Sign In for Pricing
View Details
A Disintegrin And Metalloproteinase With Thrombospondin 1 (ADAMTS1)
139006 200 µL

A Disintegrin And Metalloproteinase With Thrombospondin 1 (ADAMTS1)

Sign In for Pricing
View Details
Anti-VSIG2 Antibody
CPA5356-01 30 µL

Anti-VSIG2 Antibody

Sign In for Pricing
View Details
Anti-VSIG2 Antibody
CPA5356-02 50 μL

Anti-VSIG2 Antibody

Sign In for Pricing
View Details
Anti-VSIG2 Antibody
CPA5356-03 100 µL

Anti-VSIG2 Antibody

Sign In for Pricing
View Details
Anti-VSIG2 Antibody
CPA5356-04 200 µL

Anti-VSIG2 Antibody

Sign In for Pricing
View Details