Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHR Peptide - N-terminal region

GHR Peptide - N-terminal region

Product Specifications

Product Name Alternative

GHR

UniProt

P10912

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHR Rabbit Polyclonal Antibody (orb579097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexachlorobenzene-13C6
TRC-H290817-10MG 10 mg

Hexachlorobenzene-13C6

Sign In for Pricing
View Details
1-Ethyl-6-oxo-3-piperidinecarboxylic Acid
TRC-B440660-250MG 250 mg

1-Ethyl-6-oxo-3-piperidinecarboxylic Acid

Sign In for Pricing
View Details
Human SERINC2 activation kit by CRISPRa
GA117663 1 Kit

Human SERINC2 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Nitro[1,1'-biphenyl]-2,2'-diamine
TRC-N494020-250MG 250 mg

5-Nitro[1,1'-biphenyl]-2,2'-diamine

Sign In for Pricing
View Details
Pneumocystis jirovecii TaqMan PCR Kit
TM42850 100 Reactions

Pneumocystis jirovecii TaqMan PCR Kit

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast, left
CB641678 1 Block

Frozen Tissue Blocks, Breast, left

Sign In for Pricing
View Details