Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHR Peptide - N-terminal region

GHR Peptide - N-terminal region

Product Specifications

Product Name Alternative

GHR

UniProt

P10912

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHR Rabbit Polyclonal Antibody (orb579097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS804888 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
C1orf189 (NM_001010979) Human Over-expression Lysate
LY423252 100 µg

C1orf189 (NM_001010979) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS707488 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
IDUA Human Gene Knockout Kit (CRISPR)
KN419336 1 Kit

IDUA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit
E-EL-M3115-01 24 Tests

Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit

Sign In for Pricing
View Details
Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit
E-EL-M3115-02 48 Tests

Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit

Sign In for Pricing
View Details