Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT2 Peptide - C-terminal region

CSGALNACT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSGALNACT2, CHGN2, GALNACT2, PRO0082

UniProt

Q8N6G5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSGALNACT2 Rabbit Polyclonal Antibody (orb580696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYNPAIVYANQEVPPPVEQQLVHKKDSGFWRDFGFGMTCQYRSDFLTIGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhbdl3 Mouse Gene Knockout Kit (CRISPR)
KN514756 1 Kit

Rhbdl3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAMD13 (NM_001010971) Human Over-expression Lysate
LY423246 100 µg

SAMD13 (NM_001010971) Human Over-expression Lysate

Sign In for Pricing
View Details
1-O-Dodecyl-rac-glycerol
TRC-D525520-5G 5 g

1-O-Dodecyl-rac-glycerol

Sign In for Pricing
View Details
IL3RA Human Recombinant Protein
TP723926 100 µg

IL3RA Human Recombinant Protein

Sign In for Pricing
View Details
GATA1 (Ab-142) Antibody
8B7092-AAT 50 µg

GATA1 (Ab-142) Antibody

Sign In for Pricing
View Details
Recombinant Human UBE1/UBA1 Protein (His & GST Tag)
PKSH030942 50 µg

Recombinant Human UBE1/UBA1 Protein (His & GST Tag)

Sign In for Pricing
View Details