Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT2 Peptide - C-terminal region

CSGALNACT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSGALNACT2, CHGN2, GALNACT2, PRO0082

UniProt

Q8N6G5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSGALNACT2 Rabbit Polyclonal Antibody (orb580696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYNPAIVYANQEVPPPVEQQLVHKKDSGFWRDFGFGMTCQYRSDFLTIGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB43 (NM_001135776) Human Over-expression Lysate
LC427708 20 µg

ZBTB43 (NM_001135776) Human Over-expression Lysate

Sign In for Pricing
View Details
Drop-n-Stain EverBriteTM Mounting Medium
#23008-T 1x 2 mL

Drop-n-Stain EverBriteTM Mounting Medium

Sign In for Pricing
View Details
Calpain 1 (CAPN1) Human Knockdown Lysate
LY300083 100 µg

Calpain 1 (CAPN1) Human Knockdown Lysate

Sign In for Pricing
View Details
MGC34774 (NM_203308) Human Recombinant Protein
TP306664M 100 µg

MGC34774 (NM_203308) Human Recombinant Protein

Sign In for Pricing
View Details
FOXO1 Human Gene Knockout Kit (CRISPR)
KN400477 1 Kit

FOXO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PARIS (ZNF746) (NM_001163474) Human Over-expression Lysate
LY432009 100 µg

PARIS (ZNF746) (NM_001163474) Human Over-expression Lysate

Sign In for Pricing
View Details