Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFRL1 Peptide - middle region

FGFRL1 Peptide - middle region

Product Specifications

Product Name Alternative

FGFRL1, FGFR5, FHFR, UNQ480/PRO943

UniProt

Q8N441

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFRL1 Rabbit Polyclonal Antibody (orb585117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005272339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Carbitol Acetate
TRC-E495975-50G 50 g

Ethyl Carbitol Acetate

Sign In for Pricing
View Details
NPAS2 Rabbit Polyclonal Antibody
TA379245 100 µL

NPAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-p53 (S376) Recombinant Rabbit Monoclonal Antibody [ST0440]
ET1609-14 100 µL

Phospho-p53 (S376) Recombinant Rabbit Monoclonal Antibody [ST0440]

Sign In for Pricing
View Details
Recombinant NDUFS8 Antibody
RC-4563-01 50 μL

Recombinant NDUFS8 Antibody

Sign In for Pricing
View Details
Recombinant NDUFS8 Antibody
RC-4563-02 100 µL

Recombinant NDUFS8 Antibody

Sign In for Pricing
View Details
Recombinant NDUFS8 Antibody
RC-4563-03 1 mL

Recombinant NDUFS8 Antibody

Sign In for Pricing
View Details