Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFRL1 Peptide - middle region

FGFRL1 Peptide - middle region

Product Specifications

Product Name Alternative

FGFRL1, FGFR5, FHFR, UNQ480/PRO943

UniProt

Q8N441

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFRL1 Rabbit Polyclonal Antibody (orb585117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005272339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-n-Butyl Phosphorochloridate
TRC-D429450-1G 1 g

Di-n-Butyl Phosphorochloridate

Sign In for Pricing
View Details
CF®800 Maleimide
#92128 1x 250 nmol

CF®800 Maleimide

Sign In for Pricing
View Details
BrdU Recombinant Antibody [PSH0-18] - Mouse IgG1 (Chimeric)
HA601222 100 µL

BrdU Recombinant Antibody [PSH0-18] - Mouse IgG1 (Chimeric)

Sign In for Pricing
View Details
MIRO1 (RHOT1) Human Gene Knockout Kit (CRISPR)
KN209190LP 1 Kit

MIRO1 (RHOT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCmL1 (NM_001037540) Human Over-expression Lysate
LC421922 20 µg

SCmL1 (NM_001037540) Human Over-expression Lysate

Sign In for Pricing
View Details
SNAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]
TA502967AM 100 µL

SNAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details