Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPXN Peptide - C-terminal region

LPXN Peptide - C-terminal region

Product Specifications

Product Name Alternative

LPXN, LDLP

UniProt

O60711

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPXN Rabbit Polyclonal Antibody (orb585165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004802

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenine sulfate
GE5051-25g 25 g

Adenine sulfate

Sign In for Pricing
View Details
Diethylene Glycol
D9720-01 100 mL

Diethylene Glycol

Sign In for Pricing
View Details
Diethylene Glycol
D9720-02 500 mL

Diethylene Glycol

Sign In for Pricing
View Details
Light Green SF Yellowish
T20913 1 g

Light Green SF Yellowish

Sign In for Pricing
View Details
Oct4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-63076R-BF680 100 µL

Oct4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Satb1 (NM_001163630) Mouse Tagged Lenti ORF Clone
MR223653L4 10 µg

Satb1 (NM_001163630) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details