Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPOX Peptide - C-terminal region

CPOX Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPOX, CPO, CPX

UniProt

P36551

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPOX Rabbit Polyclonal Antibody (orb331301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000088

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVFRFVQSCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit
MBS9910969-01 48 Well

Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit

Sign In for Pricing
View Details
Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit
MBS9910969-02 96 Well

Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit

Sign In for Pricing
View Details
Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit
MBS9910969-03 5x 96 Well

Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit

Sign In for Pricing
View Details
Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit
MBS9910969-04 10x 96 Well

Horse Inactive Tyrosine-Protein Kinase 7 (PTK7) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PIGA shRNA (UAS) - Lentiviral human PIGA shRNA (UAS, iRFP) plasmid
GTR15327595 1 Vial

Lentiviral human PIGA shRNA (UAS) - Lentiviral human PIGA shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MRTF-A Polyclonal Antibody
E20-72895 100 µg

MRTF-A Polyclonal Antibody

Sign In for Pricing
View Details