Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL27A Peptide - N-terminal region

RPL27A Peptide - N-terminal region

Product Specifications

Product Name Alternative

RPL27A

UniProt

P46776

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL27A Rabbit Polyclonal Antibody (orb586271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000981

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1134 Protein Vector (Mouse) (pPB-C-His)
PV208302 500 ng

Olfr1134 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
BluPAD LED Transilluminator
BP001CU 1 Unit

BluPAD LED Transilluminator

Sign In for Pricing
View Details
Falcon Hts 24 Well 3um Multiwell Multipack Insert System With Plate And Dish
351183 5 / PCK

Falcon Hts 24 Well 3um Multiwell Multipack Insert System With Plate And Dish

Sign In for Pricing
View Details
Porcine G-Protein Coupled Receptor-Associated Sorting Protein 1 (GPRASP1) ELISA Kit
MBS9396211-01 48 Well

Porcine G-Protein Coupled Receptor-Associated Sorting Protein 1 (GPRASP1) ELISA Kit

Sign In for Pricing
View Details
Porcine G-Protein Coupled Receptor-Associated Sorting Protein 1 (GPRASP1) ELISA Kit
MBS9396211-02 96 Well

Porcine G-Protein Coupled Receptor-Associated Sorting Protein 1 (GPRASP1) ELISA Kit

Sign In for Pricing
View Details
Porcine G-Protein Coupled Receptor-Associated Sorting Protein 1 (GPRASP1) ELISA Kit
MBS9396211-03 5x 96 Well

Porcine G-Protein Coupled Receptor-Associated Sorting Protein 1 (GPRASP1) ELISA Kit

Sign In for Pricing
View Details