H3F3A Peptide - N-terminal region
H3F3A Peptide - N-terminal region
Product Specifications
Product Name Alternative
H3F3A, H3.3B
UniProt
P84243
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with H3F3A Rabbit Polyclonal Antibody (orb586440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005315
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY423102 100 µg
PSMA (FOLH1) (NM_001014986) Human Over-expression Lysate
Sign In for Pricing
View Details 
