SPINK9 Peptide - middle region
SPINK9 Peptide - middle region
Product Specifications
Product Name Alternative
SPINK9, LEKTI2
UniProt
Q5DT21
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPINK9 Rabbit Polyclonal Antibody (orb586749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0181-01 5x 96 Tests
Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0181-02 15x 96 Tests
Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
Sign In for Pricing
View Details ![AKT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G8]](https://cdn.genprice.uk/products/937/68dd1b65061270361ea14095/imageurl/ta500808bm.webp)
TA500808BM 100 µL
AKT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G8]
Sign In for Pricing
View Details 
![TSHZ1 Mouse Monoclonal Antibody [Clone ID: OTI8B9]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908882/imageurl/cf809980.webp)
