Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK9 Peptide - middle region

SPINK9 Peptide - middle region

Product Specifications

Product Name Alternative

SPINK9, LEKTI2

UniProt

Q5DT21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINK9 Rabbit Polyclonal Antibody (orb586749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRIM42 activation kit by CRISPRa
GA117312 1 Kit

Human TRIM42 activation kit by CRISPRa

Sign In for Pricing
View Details
2-(Phenylamino)nicotinic Acid
TRC-P400593-5MG 5 mg

2-(Phenylamino)nicotinic Acid

Sign In for Pricing
View Details
Recombinant APTX Antibody
RC-4205-01 50 μL

Recombinant APTX Antibody

Sign In for Pricing
View Details
Recombinant APTX Antibody
RC-4205-02 100 µL

Recombinant APTX Antibody

Sign In for Pricing
View Details
Recombinant APTX Antibody
RC-4205-03 1 mL

Recombinant APTX Antibody

Sign In for Pricing
View Details
P2Y12 Recombinant Rabbit Monoclonal Antibody [PSH04-48]
HA722133 100 µL

P2Y12 Recombinant Rabbit Monoclonal Antibody [PSH04-48]

Sign In for Pricing
View Details