Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1 Peptide - C-terminal region

BTN3A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BTN3A1, BTF5

UniProt

O00481

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTN3A1 Rabbit Polyclonal Antibody (orb586770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoamyl Alcohol
TRC-I780010-10G 10 g

Isoamyl Alcohol

Sign In for Pricing
View Details
MBNL1 (NM_207296) Human Recombinant Protein
TP323216M 100 µg

MBNL1 (NM_207296) Human Recombinant Protein

Sign In for Pricing
View Details
Atp5k Mouse Gene Knockout Kit (CRISPR)
KN501799 1 Kit

Atp5k Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heptobarbital
TRC-H281165-1G 1 g

Heptobarbital

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS620122 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
CINP Antibody (Biotin)
KB-1276-01 50 μL

CINP Antibody (Biotin)

Sign In for Pricing
View Details