BTN3A1 Peptide - C-terminal region
BTN3A1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BTN3A1, BTF5
UniProt
O00481
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BTN3A1 Rabbit Polyclonal Antibody (orb586770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDEH101093-02 100 µg
Recombinant Human AKT1 protein (SUMO, His tag)
Sign In for Pricing
View Details PDEH101093-03 500 µg
Recombinant Human AKT1 protein (SUMO, His tag)
Sign In for Pricing
View Details 
TRC-D238210-10MG 10 mg
ι,theta-Dihydroxy-3-pentyl-2-oxiraneundecanoic Acid
Sign In for Pricing
View Details