PARPBP Peptide - C-terminal region
PARPBP Peptide - C-terminal region
Product Specifications
Product Name Alternative
PARPBP, C12orf48, PARI
UniProt
Q9NWS1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PARPBP Rabbit Polyclonal Antibody (orb586947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKCTAKDKLISGQAKLTQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2164-500 1x 500 µL
CD163 (Monocyte & Macrophage Marker) (M130/2164), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details