Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA5L1 Peptide - middle region

SPATA5L1 Peptide - middle region

Product Specifications

Product Name Alternative

SPATA5L1

UniProt

Q9BVQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA5L1 Rabbit Polyclonal Antibody (orb587117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELLAVSAPALQGSRPGETEENVRRVFQRARELASRGPSLLFLDEMDALCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Phenyl-2,4-pyrrolidinedione
TRC-P998415-500MG 500 mg

1-Phenyl-2,4-pyrrolidinedione

Sign In for Pricing
View Details
anti-MYD88
YF-PA27304 50 ul

anti-MYD88

Sign In for Pricing
View Details
Human B4GALT4 Pre-designed siRNA Set A
SI001399A 1 Each

Human B4GALT4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD29 (Phospho-T789) Rabbit Polyclonal Antibody
orb393087-01 30 µL

CD29 (Phospho-T789) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD29 (Phospho-T789) Rabbit Polyclonal Antibody
orb393087-02 50 μL

CD29 (Phospho-T789) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD29 (Phospho-T789) Rabbit Polyclonal Antibody
orb393087-03 100 µL

CD29 (Phospho-T789) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details