Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC97 Peptide - N-terminal region

CCDC97 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC97

UniProt

Q96F63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC97 Rabbit Polyclonal Antibody (orb587173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443080

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD2 Polyclonal Antibody
E-AB-19433-01 20 µL

ABHD2 Polyclonal Antibody

Sign In for Pricing
View Details
ABHD2 Polyclonal Antibody
E-AB-19433-02 60 µL

ABHD2 Polyclonal Antibody

Sign In for Pricing
View Details
ABHD2 Polyclonal Antibody
E-AB-19433-03 120 µL

ABHD2 Polyclonal Antibody

Sign In for Pricing
View Details
ABHD2 Polyclonal Antibody
E-AB-19433-04 200 µL

ABHD2 Polyclonal Antibody

Sign In for Pricing
View Details
Human IL-4, Tag Free
HA210763-01 20 µg

Human IL-4, Tag Free

Sign In for Pricing
View Details
Human IL-4, Tag Free
HA210763-02 50 µg

Human IL-4, Tag Free

Sign In for Pricing
View Details