Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC97 Peptide - N-terminal region

CCDC97 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC97

UniProt

Q96F63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC97 Rabbit Polyclonal Antibody (orb587173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443080

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atibuclimab Biosimilar - Research Grade
ICH5016-1mg 1 mg

Atibuclimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF640R conjugate, 0.1mg/mL
BNC400688-100 1x 100 µL

Cytokeratin 8 (C-43), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Seminal vesicle
CS802724 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details
4-Chlorobenzenesulfonyl Chloride
TRC-C253496-1G 1 g

4-Chlorobenzenesulfonyl Chloride

Sign In for Pricing
View Details
Isoleucine
TRC-I818948-50MG 50 mg

Isoleucine

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF488A conjugate, 0.1mg/mL
BNC882125-500 1x 500 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details