Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C4orf45 Peptide - C-terminal region

C4orf45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4orf45

UniProt

Q96LM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C4orf45 Rabbit Polyclonal Antibody (orb587241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689756

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKKEKKRKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), 1mg/mL
BNUM1820-50 1x 50 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), 1mg/mL

Sign In for Pricing
View Details
Rabbit IgG (H&L) Antibody Fluorescein Conjugated
TA397988 2 mg

Rabbit IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
VAMP4 (NM_001185127) Human Over-expression Lysate
LC433976 20 µg

VAMP4 (NM_001185127) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIB3 Polyclonal Antibody
E-AB-17150-01 20 µL

TRIB3 Polyclonal Antibody

Sign In for Pricing
View Details
TRIB3 Polyclonal Antibody
E-AB-17150-02 60 µL

TRIB3 Polyclonal Antibody

Sign In for Pricing
View Details