Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKDD1A Peptide - C-terminal region

ANKDD1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANKDD1A

UniProt

Q495B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKDD1A Rabbit Polyclonal Antibody (orb587292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKG2 Antibody (Center) Blocking Peptide
MBS9226699-01 0.5 mg

PHKG2 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
PHKG2 Antibody (Center) Blocking Peptide
MBS9226699-02 5x 0.5 mg

PHKG2 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
PKM2 Rabbit Polyclonal Antibody (Fluoro594)
orb3077677 100 µg

PKM2 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
PI5L1 Polyclonal Antibody
JOT-AP13029-01 20 µL

PI5L1 Polyclonal Antibody

Sign In for Pricing
View Details
PI5L1 Polyclonal Antibody
JOT-AP13029-02 50 μL

PI5L1 Polyclonal Antibody

Sign In for Pricing
View Details
PI5L1 Polyclonal Antibody
JOT-AP13029-03 100 µL

PI5L1 Polyclonal Antibody

Sign In for Pricing
View Details