Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKDD1A Peptide - C-terminal region

ANKDD1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANKDD1A

UniProt

Q495B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKDD1A Rabbit Polyclonal Antibody (orb587292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenylpyrimidine
sc-260095 500 mg

2-Phenylpyrimidine

Sign In for Pricing
View Details
Rat TNFRSF1B shRNA Plasmid
abx987570-01 150 µg

Rat TNFRSF1B shRNA Plasmid

Sign In for Pricing
View Details
Rat TNFRSF1B shRNA Plasmid
abx987570-02 300 µg

Rat TNFRSF1B shRNA Plasmid

Sign In for Pricing
View Details
One-Way Luer-Lock Clear Stopcock, 20 pack
S7001 20 Pieces

One-Way Luer-Lock Clear Stopcock, 20 pack

Sign In for Pricing
View Details
IBGC1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV729105 1.0 µg DNA

IBGC1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Cavy Kinesin-Like Protein KIFC1 (KIFC1) ELISA Kit
MBS9926778 Inquire

Cavy Kinesin-Like Protein KIFC1 (KIFC1) ELISA Kit

Sign In for Pricing
View Details