Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP73 Peptide - N-terminal region

CFAP73 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MIA2, CCDC42B

UniProt

A6NFT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP73 Rabbit Polyclonal Antibody (orb326920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005253936

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRWEQLEQKERELKGSFIRFDKFLQDSEARRNRALRRAAEERHQAGRREV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POLE4 Knockout HEK293T cell line
GTR15417312 1 Vial

Human POLE4 Knockout HEK293T cell line

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)
MBS2078196-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)
MBS2078196-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)
MBS2078196-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)
MBS2078196-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)
MBS2078196-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Histidine Decarboxylase (HDC)

Sign In for Pricing
View Details