Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP73 Peptide - N-terminal region

CFAP73 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MIA2, CCDC42B

UniProt

A6NFT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP73 Rabbit Polyclonal Antibody (orb326920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005253936

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRWEQLEQKERELKGSFIRFDKFLQDSEARRNRALRRAAEERHQAGRREV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit
MBS9396975-01 48 Well

Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit
MBS9396975-02 96 Well

Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit
MBS9396975-03 5x 96 Well

Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit
MBS9396975-04 10x 96 Well

Bovine Multidrug Resistance Protein 1B (MDR1B) ELISA Kit

Sign In for Pricing
View Details
Centaurin beta 2 Recombinant Antibody, Cy5.5 Conjugated
bsm-62728R-Cy5.5 100 µL

Centaurin beta 2 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Zpbp sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6636908 1.0 µg DNA

Zpbp sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details