LRRC75A Peptide - N-terminal region
LRRC75A Peptide - N-terminal region
Product Specifications
Product Name Alternative
FAM211A, C17orf76
UniProt
Q8NAA5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRC75A Rabbit Polyclonal Antibody (orb326924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997270
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12B8]](https://cdn.genprice.uk/products/937/6868c368994c49e6dc3f69a0/imageurl/ta505855am.webp)
TA505855AM 100 µL
SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12B8]
Sign In for Pricing
View Details 