Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC75A Peptide - N-terminal region

LRRC75A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAM211A, C17orf76

UniProt

Q8NAA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC75A Rabbit Polyclonal Antibody (orb326924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997270

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Human CD90 Antibody[5E10]
E-AB-F1167E-01 20 Tests

APC Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
APC Anti-Human CD90 Antibody[5E10]
E-AB-F1167E-02 100 Tests

APC Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
APC Anti-Human CD90 Antibody[5E10]
E-AB-F1167E-03 2x 100 Tests

APC Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
TRIP15 (COPS2) (NM_001143887) Human Over-expression Lysate
LY428394 100 µg

TRIP15 (COPS2) (NM_001143887) Human Over-expression Lysate

Sign In for Pricing
View Details
Homovanillic Acid
TRC-H669500-50MG 50 mg

Homovanillic Acid

Sign In for Pricing
View Details
1700003F12Rik Mouse Gene Knockout Kit (CRISPR)
KN500060 1 Kit

1700003F12Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details