C10orf120 Peptide - C-terminal region
C10orf120 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C10orf120
UniProt
Q5SQS8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C10orf120 Rabbit Polyclonal Antibody (orb326936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001010912
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSFLSGVGLGPMAKNKARRKEDNYDTHNCDDANQDKKEEAEGKNTKRREI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402156-100 1x 100 µL
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details