Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf58 Peptide - C-terminal region

C8orf58 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C8orf58

UniProt

Q8NAV2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf58 Rabbit Polyclonal Antibody (orb587321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775957

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHHPEPPAPPDGSDPRIESRDLPERPQCRPHRKTFMPSLVVKKQRAKNLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EPB41L5 Protein
E30P6623 20 µg

Recombinant Human EPB41L5 Protein

Sign In for Pricing
View Details
FastScan™ Phospho-Akt1 (Ser473) ELISA Kit
CST 54336V4 50 Kits

FastScan™ Phospho-Akt1 (Ser473) ELISA Kit

Sign In for Pricing
View Details
VCP(Phospho Ser352) Polyclonal Antibody
JOT-AP15443-01 20 µL

VCP(Phospho Ser352) Polyclonal Antibody

Sign In for Pricing
View Details
VCP(Phospho Ser352) Polyclonal Antibody
JOT-AP15443-02 50 μL

VCP(Phospho Ser352) Polyclonal Antibody

Sign In for Pricing
View Details
VCP(Phospho Ser352) Polyclonal Antibody
JOT-AP15443-03 100 µL

VCP(Phospho Ser352) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa recR Protein (aa 1-198)
VAng-Cr0109-1mgEcoli 1 mg (E. coli)

Recombinant Pseudomonas Aeruginosa recR Protein (aa 1-198)

Sign In for Pricing
View Details