CCDC183 Peptide - N-terminal region
CCDC183 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CCDC183, KIAA1984
UniProt
Q5T5S1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC183 Rabbit Polyclonal Antibody (orb327014) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLVRRRGQKLESMQLELDSLRSQPDASKEELRLLQIIRQLENNIEKTMIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B433862-5MG 5 mg
2,4-Bis(2-ethylhexyl) Benzene-1,2,4-tricarboxylic Acid 1-Benzyl Ester-d34
Sign In for Pricing
View Details 