CCDC183 Peptide - N-terminal region
CCDC183 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CCDC183, KIAA1984
UniProt
Q5T5S1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC183 Rabbit Polyclonal Antibody (orb327014) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLVRRRGQKLESMQLELDSLRSQPDASKEELRLLQIIRQLENNIEKTMIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSQ050001 100 µg
Recombinant Aequorea victoria GFP Protein (His Tag)
Sign In for Pricing
View Details ![MTA2 Mouse Monoclonal Antibody [17A1]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea814a0/imageurl/em1901-34.webp)
