Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL30 Peptide - C-terminal region

KLHL30 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLHL30

UniProt

Q0D2K2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL30 Rabbit Polyclonal Antibody (orb587497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940984

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAWSVIASPFLPKYLSSPRCAALHGELYLIGDNTKKVYVYDPGANLWQKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL17 (39S Ribosomal Protein L17, Mitochondrial, L17mt, MRP-L17, LYST-interacting Protein 2, MRPL17, LIP2) (MaxLight 405) discontinued
302569-ML405 100 µL

MRPL17 (39S Ribosomal Protein L17, Mitochondrial, L17mt, MRP-L17, LYST-interacting Protein 2, MRPL17, LIP2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human CD132/IL2RG Protein, C-His
EHD96701 100 μg

Recombinant Human CD132/IL2RG Protein, C-His

Sign In for Pricing
View Details
LOC685406 Rat shRNA Lentiviral Particle (Locus ID 685406)
TL703891V 500 µL Each

LOC685406 Rat shRNA Lentiviral Particle (Locus ID 685406)

Sign In for Pricing
View Details
F3 Antibody
K06319M07D02C-01 50 ug

F3 Antibody

Sign In for Pricing
View Details
F3 Antibody
K06319M07D02C-02 100 ug

F3 Antibody

Sign In for Pricing
View Details
F3 Antibody
K06319M07D02C-03 1 mg

F3 Antibody

Sign In for Pricing
View Details