Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL30 Peptide - C-terminal region

KLHL30 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLHL30

UniProt

Q0D2K2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL30 Rabbit Polyclonal Antibody (orb587497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940984

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAWSVIASPFLPKYLSSPRCAALHGELYLIGDNTKKVYVYDPGANLWQKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP14 Antibody
E19-9982-2 100 µg -100 µL

USP14 Antibody

Sign In for Pricing
View Details
Itga7 siRNA Oligos set (Rat)
25155176 3x 5 nmol

Itga7 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
KD-Validated Anti-Mitochondrial Ribosomal Protein S15 Rabbit Monoclonal Antibody
AGI1584-100 100 µL

KD-Validated Anti-Mitochondrial Ribosomal Protein S15 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CGI-58 Antibody
3901-30T 30 µg

CGI-58 Antibody

Sign In for Pricing
View Details
IRF3 Adenovirus (Human)
25082051 1.0 mL

IRF3 Adenovirus (Human)

Sign In for Pricing
View Details
POLR3GL siRNA (Mouse)
orb1841183-01 15 nmol

POLR3GL siRNA (Mouse)

Sign In for Pricing
View Details