MAGEB10 Peptide - N-terminal region
MAGEB10 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAGEB10
UniProt
Q96LZ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAGEB10 Rabbit Polyclonal Antibody (orb587528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_872312
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DZ41599-PE 200 µL/Vial
Anti-Filarial nematode worm BmLec-2 Antibody, PE Conjugate
Sign In for Pricing
View Details 
246428-PE 100 µL
GABARAP (GABA (A) Receptor-Associated Protein, FLJ25768, MGC120154, MGC120155, MM46) (PE)
Sign In for Pricing
View Details RSPEC-EP0064 1 Cuvette
Reagecon Spectrophotometry Holmium Oxide UV and Visible Wavelength Standard 240nm to 640nm (Ph. Eur)
Sign In for Pricing
View Details 
TP318427M 100 µg
Decorin (DCN) (NM_133506) Human Recombinant Protein
Sign In for Pricing
View Details