OBP2A Peptide - middle region
OBP2A Peptide - middle region
Product Specifications
Product Name Alternative
OBP2A
UniProt
Q9NY56
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OBP2A Rabbit Polyclonal Antibody (orb587573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIY
More Discoveries
Explore Other Products
Browse additional items from our catalog
H00006813-P01-25ug 25 µg
Recombinant Human Syntaxin-BP2 Protein - (Dry Ice)
Sign In for Pricing
View Details 
MBS6349249-01 0.1 mL
SNAPC1, ID (SNAPC1, SNAP43, snRNA-activating protein complex subunit 1, Proximal sequence element-binding transcription factor subunit gamma, Small nuclear RNA-activating complex polypeptide 1, snRNA-activating protein complex 43kD subunit) (MaxLight 490)
Sign In for Pricing
View Details MBS6349249-02 5x 0.1 mL
SNAPC1, ID (SNAPC1, SNAP43, snRNA-activating protein complex subunit 1, Proximal sequence element-binding transcription factor subunit gamma, Small nuclear RNA-activating complex polypeptide 1, snRNA-activating protein complex 43kD subunit) (MaxLight 490)
Sign In for Pricing
View Details