Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OBP2A Peptide - middle region

OBP2A Peptide - middle region

Product Specifications

Product Name Alternative

OBP2A

UniProt

Q9NY56

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OBP2A Rabbit Polyclonal Antibody (orb587573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ntrk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4391107 1.0 µg DNA

Ntrk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PRRVRLK (acetate)
HY-P3438A-01 5 mg

PRRVRLK (acetate)

Sign In for Pricing
View Details
PRRVRLK (acetate)
HY-P3438A-02 10 mg

PRRVRLK (acetate)

Sign In for Pricing
View Details
PRRVRLK (acetate)
HY-P3438A-03 25 mg

PRRVRLK (acetate)

Sign In for Pricing
View Details
PRRVRLK (acetate)
HY-P3438A-04 50 mg

PRRVRLK (acetate)

Sign In for Pricing
View Details
PRRVRLK (acetate)
HY-P3438A-05 100 mg

PRRVRLK (acetate)

Sign In for Pricing
View Details