Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEFL1 Peptide - middle region

RAPGEFL1 Peptide - middle region

Product Specifications

Product Name Alternative

RAPGEFL1

UniProt

Q9UHV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEFL1 Rabbit Polyclonal Antibody (orb587733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057423

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-2Rβ discontinued
343929-01 100 µL

IL-2Rβ discontinued

Sign In for Pricing
View Details
IL-2Rβ discontinued
343929-02 200 µL

IL-2Rβ discontinued

Sign In for Pricing
View Details
Arachidonate 5-lipoxygenase Antibody
orb19321 100 µg

Arachidonate 5-lipoxygenase Antibody

Sign In for Pricing
View Details
3-Carboxyumbelliferyl b-D-glucuronide
257619-01 1 mg

3-Carboxyumbelliferyl b-D-glucuronide

Sign In for Pricing
View Details
3-Carboxyumbelliferyl b-D-glucuronide
257619-02 5 mg

3-Carboxyumbelliferyl b-D-glucuronide

Sign In for Pricing
View Details
3-Carboxyumbelliferyl b-D-glucuronide
257619-03 10 mg

3-Carboxyumbelliferyl b-D-glucuronide

Sign In for Pricing
View Details