Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC8 Peptide - C-terminal region

ERCC8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERCC8, CKN1, CSA

UniProt

Q13216

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC8 Rabbit Polyclonal Antibody (orb587883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000073

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (MaxLight 650)
MBS6377038-01 0.1 mL

EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (MaxLight 650)

Sign In for Pricing
View Details
EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (MaxLight 650)
MBS6377038-02 5x 0.1 mL

EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (MaxLight 650)

Sign In for Pricing
View Details
Mcoln3 Mouse Gene Knockout Kit (CRISPR)
KN509885 1 Kit

Mcoln3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTH, Parathyroid Hormone (1-84), human
RC412-16 20ug

PTH, Parathyroid Hormone (1-84), human

Sign In for Pricing
View Details
Recombinant Mouse Phospholipid transfer protein (Pltp)
MBS1205782-01 0.02 mg (E-Coli)

Recombinant Mouse Phospholipid transfer protein (Pltp)

Sign In for Pricing
View Details
Recombinant Mouse Phospholipid transfer protein (Pltp)
MBS1205782-02 0.02 mg (Baculovirus)

Recombinant Mouse Phospholipid transfer protein (Pltp)

Sign In for Pricing
View Details