Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC8 Peptide - C-terminal region

ERCC8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERCC8, CKN1, CSA

UniProt

Q13216

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC8 Rabbit Polyclonal Antibody (orb587883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000073

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody
abx348389-01 20 µL

Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody

Sign In for Pricing
View Details
Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody
abx348389-02 50 µL

Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody

Sign In for Pricing
View Details
Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody
abx348389-03 100 µL

Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody

Sign In for Pricing
View Details
Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody
abx348389-04 200 µL

Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody

Sign In for Pricing
View Details
Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody
abx348389-05 1 mL

Protein mono-ADP-ribosyltransferase PARP8 (PARP8) Antibody

Sign In for Pricing
View Details
Bz-Arg-OH
5-02409 25 g

Bz-Arg-OH

Sign In for Pricing
View Details