Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA9 Peptide - C-terminal region

HOXA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA9, HOX1G

UniProt

P31269

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA9 Rabbit Polyclonal Antibody (orb331406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689952

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEST3 Antibody - N-terminal region
ARP50109_P050-25UL 25 µL

BEST3 Antibody - N-terminal region

Sign In for Pricing
View Details
DNAL1 (C-term) rabbit polyclonal antibody
AP23469PU-N 50 µg

DNAL1 (C-term) rabbit polyclonal antibody

Sign In for Pricing
View Details
(R) -Phenylephrine-d3 Glucuronide
sc-478604 1 mg

(R) -Phenylephrine-d3 Glucuronide

Sign In for Pricing
View Details
Rabbit Monoclonal Choline Acetyltransferase/ChAT Antibody (1I4V0)
NBP3-15621-20ul 20 µL

Rabbit Monoclonal Choline Acetyltransferase/ChAT Antibody (1I4V0)

Sign In for Pricing
View Details
(1R,2R,5R,6S,9R,10S) -1,2,5,6,9,10-Hexabromocyclododecane
RG-H052404-01 10 mg

(1R,2R,5R,6S,9R,10S) -1,2,5,6,9,10-Hexabromocyclododecane

Sign In for Pricing
View Details
(1R,2R,5R,6S,9R,10S) -1,2,5,6,9,10-Hexabromocyclododecane
RG-H052404-02 25 mg

(1R,2R,5R,6S,9R,10S) -1,2,5,6,9,10-Hexabromocyclododecane

Sign In for Pricing
View Details